
LL-37 Complex (5mg)
- Broad-spectrum defense against bacteria, viruses & fungi
- Supports tissue regeneration and wound healing
- Helps regulate inflammation & immune activity
- May improve skin health, gut integrity & respiratory protection
- Enhanced formulation for improved stability & research utility
- Ideal for advanced recovery, immune modulation & anti-infective research
- 30-Day Money-Back Guarantee
Free shipping
on orders over $300
Secure Checkout
safe online payments
Estimated delivery
3 business days
LL-37, a member of the cathelicidin family, stands out as the only known human cathelicidin, which is a diverse protein family renowned for its antimicrobial properties. This peptide, primarily located in macrophages and polymorphonuclear leukocytes, crucial white blood cell types, exhibits multifaceted functions, including antimicrobial, antibacterial, antiviral, and anti-fungal activities. Beyond its role in combating infections, LL-37 has been recognized for its anti-inflammatory properties, contributing to the regulation of immune responses.
Recent research has expanded our understanding of LL-37’s impact, revealing its potential against certain cancers. The peptide has demonstrated anticancer effects, suggesting a promising avenue for therapeutic intervention. Additionally, LL-37 has been implicated in promoting blood vessel growth in specific contexts, showcasing its involvement in processes crucial for tissue repair and regeneration. The broad spectrum of LL-37’s functions underscores its significance not only in the immune system’s defense against pathogens but also in influencing diverse physiological processes, ranging from autoimmune diseases to wound healing.
Issued under Alpha Bio Med Labs, the authorized testing and distribution partner.

The chemical structure of LL-37 is that of a cathelicidin peptide, a type of antimicrobial peptide. The specific amino acid sequence of LL-37 is as follows:
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.
This sequence represents the primary structure of LL-37, where each letter corresponds to a specific amino acid. LL-37 is a relatively short peptide consisting of 37 amino acids and is known for its diverse functions, including antimicrobial, anti-inflammatory, and potential roles in cancer and wound healing.
Antimicrobial Properties
LL-37, as a member of the cathelicidin family, exhibits potent antimicrobial effects. It serves as a natural defense mechanism against various microorganisms, including bacteria, viruses, and fungi. LL-37’s ability to disrupt the integrity of microbial cell membranes contributes to its effectiveness in combating a broad spectrum of pathogens.
Antibacterial Actions
LL-37 demonstrates specific antibacterial activity, targeting various bacterial strains. Its capacity to interact with bacterial membranes and disrupt cellular functions makes it a valuable component in the body’s defense against bacterial infections.
Antiviral Characteristics
LL-37 also exhibits antiviral properties, playing a role in the body’s defense against viral infections. Its mechanisms involve interference with viral entry and replication, contributing to the overall antiviral defense system.
Anti-fungal Effects
In addition to its antimicrobial actions, LL-37 has antifungal properties, making it effective against certain fungal pathogens. It contributes to the prevention and control of fungal infections by disrupting fungal cell membranes and functions.
Anti-inflammatory Functions
LL-37 serves as an anti-inflammatory agent, participating in the regulation of the immune response. By modulating inflammatory processes, LL-37 helps maintain a balanced immune system and contributes to the resolution of inflammation associated with various conditions.
These multifaceted effects highlight LL-37’s crucial role in the innate immune system, providing protection against a diverse range of microbial threats and contributing to overall immune homeostasis.
Direct & scientific
- Backed by 60+ scientific studies
- BPC‑157 has demonstrated consistent healing results across muscle, nerve, and gut models — with early human data showing 92% of patients reporting pain relief.
“Accelerated Healing of Muscles, Ligaments, and Tendons”
Multiple animal and human case studies show BPC-157 significantly speeds up recovery of torn muscles, damaged ligaments, and tendon-to-bone healing — especially relevant for athletes and injury rehabilitation.
PUBMED — article link
BPC comparison to others
- Muscle & joint healing
- Repairs gut lining (IBS, IBD)
- Heals gut tissue
- Boosts blood flow
- Reduces Inflammation
- Activates stem cell repair
- Long-term gut support
- Clinically backed
Product quality guarantee
We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
- $100 HPLC test fee
- Total order amount
- Shipping costs
Frequently bought together
Related products
ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.
Customer reviews










