LL-37 Complex (5mg)

The chemical structure of LL-37 is that of a cathelicidin peptide, a type of antimicrobial peptide. The specific amino acid sequence of LL-37 is as follows:

[LL-37, 37 aa]

This sequence represents the primary structure of LL-37, where each letter corresponds to a specific amino acid. LL-37 is a relatively short peptide consisting of 37 amino acids and is known for its diverse functions, including antimicrobial, anti-inflammatory, and potential roles in cancer and wound healing.

Antimicrobial Properties

LL-37, as a member of the cathelicidin family, exhibits potent antimicrobial effects. It serves as a natural defense mechanism against various microorganisms, including bacteria, viruses, and fungi. LL-37’s ability to disrupt the integrity of microbial cell membranes contributes to its effectiveness in combating a broad spectrum of pathogens.

Antibacterial Actions

LL-37 demonstrates specific antibacterial activity, targeting various bacterial strains. Its capacity to interact with bacterial membranes and disrupt cellular functions makes it a valuable component in the body’s defense against bacterial infections.

Antiviral Characteristics

LL-37 also exhibits antiviral properties, playing a role in the body’s defense against viral infections. Its mechanisms involve interference with viral entry and replication, contributing to the overall antiviral defense system.

Anti-fungal Effects

In addition to its antimicrobial actions, LL-37 has antifungal properties, making it effective against certain fungal pathogens. It contributes to the prevention and control of fungal infections by disrupting fungal cell membranes and functions.

Anti-inflammatory Functions

LL-37 serves as an anti-inflammatory agent, participating in the regulation of the immune response. By modulating inflammatory processes, LL-37 helps maintain a balanced immune system and contributes to the resolution of inflammation associated with various conditions.

These multifaceted effects highlight LL-37’s crucial role in the innate immune system, providing protection against a diverse range of microbial threats and contributing to overall immune homeostasis.