Cart
Buy $300.00 more to enjoy FREE Shipping
Based on 2K+ reviewsLL-37 (5mg)
$75.00
* A host defense peptide studied for its antimicrobial, anti-inflammatory, and wound-healing properties – ideal for immune modulation, infection control, and tissue regeneration protocols.
- Broad-spectrum antimicrobial activity (bacteria, viruses, fungi)
- Supports innate immune system & inflammation control
- Promotes tissue repair, wound healing & regeneration
- Studied for skin, lung, and gut barrier protection
- May aid in chronic infections, biofilm disruption & immune resilience
- Complements BPC-157 or TB-500 in healing protocols
- 30-Day Money-Back Guarantee
193 in stock
Free shipping
on orders over $300
Secure Checkout
safe online payments
Estimated delivery
3 business days
Description
Product Details
COAs
Chemical structure
Effects
LL-37 is a 37-amino acid peptide derived from cathelicidin, a naturally occurring protein in human immune cells. As part of the body’s innate defense mechanism, LL-37 plays a crucial role in combating bacterial, viral, and fungal pathogens. Research highlights its broad-spectrum antimicrobial activity, ability to modulate immune responses, and its role in promoting wound healing and tissue repair. LL-37’s antimicrobial properties extend to reducing biofilm formation, a major factor in chronic infections, making it an intriguing focus for ongoing studies into immune health and infection control.
Moreover, LL-37 has demonstrated the ability to influence cellular processes such as angiogenesis (the formation of new blood vessels), tissue regeneration, and inflammation modulation. These properties position LL-37 as a promising peptide for research into antimicrobial therapies, immune regulation, and regenerative medicine.
Derived from a naturally occurring protein in the immune system, synthetic LL-37 retains the vital functions of its natural counterpart, offering potential applications in infection management, chronic wound healing, and even inflammation-related disorders. Researchers continue to explore its potential in therapeutic applications, making LL-37 an exciting area of peptide science.
Issued under Alpha Bio Med Labs, the authorized testing and distribution partner.
LL-37 is a linear cationic amphipathic peptide composed of 37 amino acids. Its amino acid sequence is as follows:
[LL-37, 37 aa]
This structure allows LL-37 to interact with microbial membranes, disrupting their integrity and neutralizing pathogens. Its unique sequence also underpins its immunomodulatory and regenerative properties.
Broad-Spectrum Antimicrobial Activity
LL-37 exhibits potent antimicrobial properties, targeting bacteria, viruses, and fungi. Its mechanism involves binding to microbial membranes, destabilizing their structure, and neutralizing harmful pathogens. This makes LL-37 a subject of interest in research on antimicrobial resistance and chronic infections.
Reduces Biofilm Formation
Biofilms are structured communities of microorganisms that resist standard treatments. LL-37 has been shown to inhibit biofilm formation and disrupt existing biofilms, potentially improving outcomes in infections resistant to conventional antibiotics.
Supports Wound Healing and Tissue Repair
LL-37 promotes the regeneration of damaged tissues by enhancing angiogenesis and modulating inflammation. These effects make it a valuable peptide for research into chronic wound healing and regenerative medicine.
Modulates Immune Response
LL-37 helps regulate the immune system by balancing pro-inflammatory and anti-inflammatory responses. This modulation aids in reducing excessive inflammation while still supporting effective pathogen defense, offering potential insights into treatments for autoimmune and inflammatory disorders.
Anti-Inflammatory Effects
Studies have shown that LL-37 can suppress excessive inflammatory responses by interacting with immune signaling pathways. These properties make it a promising candidate for research into conditions involving chronic inflammation, such as arthritis or inflammatory bowel disease.
Potential Applications in Chronic Conditions
Emerging research suggests LL-37 may have therapeutic potential in addressing chronic infections, skin conditions like psoriasis, and even certain cancers. Its ability to influence both innate and adaptive immunity is driving interest in its broader applications.
Our difference
Product quality guarantee
We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
- $100 HPLC test fee
- Total order amount
- Shipping costs
You may also like
Frequently bought together