LL-37 (5mg)

LL-37 is a linear cationic amphipathic peptide composed of 37 amino acids. Its amino acid sequence is as follows:

[LL-37, 37 aa]

This structure allows LL-37 to interact with microbial membranes, disrupting their integrity and neutralizing pathogens. Its unique sequence also underpins its immunomodulatory and regenerative properties.

Broad-Spectrum Antimicrobial Activity

LL-37 exhibits potent antimicrobial properties, targeting bacteria, viruses, and fungi. Its mechanism involves binding to microbial membranes, destabilizing their structure, and neutralizing harmful pathogens. This makes LL-37 a subject of interest in research on antimicrobial resistance and chronic infections.

Reduces Biofilm Formation

Biofilms are structured communities of microorganisms that resist standard treatments. LL-37 has been shown to inhibit biofilm formation and disrupt existing biofilms, potentially improving outcomes in infections resistant to conventional antibiotics.

Supports Wound Healing and Tissue Repair

LL-37 promotes the regeneration of damaged tissues by enhancing angiogenesis and modulating inflammation. These effects make it a valuable peptide for research into chronic wound healing and regenerative medicine.

Modulates Immune Response

LL-37 helps regulate the immune system by balancing pro-inflammatory and anti-inflammatory responses. This modulation aids in reducing excessive inflammation while still supporting effective pathogen defense, offering potential insights into treatments for autoimmune and inflammatory disorders.

Anti-Inflammatory Effects

Studies have shown that LL-37 can suppress excessive inflammatory responses by interacting with immune signaling pathways. These properties make it a promising candidate for research into conditions involving chronic inflammation, such as arthritis or inflammatory bowel disease.

Potential Applications in Chronic Conditions

Emerging research suggests LL-37 may have therapeutic potential in addressing chronic infections, skin conditions like psoriasis, and even certain cancers. Its ability to influence both innate and adaptive immunity is driving interest in its broader applications.