
BDNF (Brain-derived neurotrophic factor) (10mg)
* A powerful neuropeptide that enhances brain plasticity, learning, and mood regulation – supporting long-term cognitive health and mental performance.
- Supports neurogenesis & synaptic plasticity
- Enhances memory, learning, and focus
- Promotes mood balance and emotional resilience
- May help protect against age-related cognitive decline
- Ideal for nootropic stacks and brain optimization
- Backed by research in neuroscience & neurorepair
- 30-Day Money-Back Guarantee
Free shipping
on orders over $300
Secure Checkout
safe online payments
Estimated delivery
3 business days
BDNF, a synthetic derivative of brain-derived neurotrophic factor, possesses multifunctional capabilities essential for brain health. This peptide promotes the growth, survival, and differentiation of neurons, making it a key player in neuroplasticity and cognitive enhancement. BDNF showcases its effectiveness in supporting learning and memory, improving mood, and providing neuroprotection.
Comprising a large and complex structure, BDNF’s ability to bind to its receptors, TrkB and p75NTR, enables it to exert its diverse biological effects. Over extended usage periods, BDNF has been shown to significantly improve cognitive function, enhance mood, and offer neuroprotective benefits. The diverse effects of BDNF include increased synaptic plasticity, improved neural health, and reduced risk of neurodegenerative diseases. Moreover, BDNF’s impact on mental health highlights its potential as a versatile agent in neurological and cognitive health management
Issued under Alpha Bio Med Labs, the authorized testing and distribution partner.

BDNF, a brain-derived neurotrophic factor, is a synthetic peptide with a specific amino acid sequence. The chemical structure and sequence of BDNF are as follows:
Mature peptide sequence:
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRH
Structure: Contains specific disulfide bridges critical for its function
Enhanced Cognitive Function
BDNF, a critical neurotrophic factor, plays a significant role in enhancing cognitive function. By promoting the growth, development, and maintenance of neurons, BDNF supports neuroplasticity, which is essential for learning and memory. This peptide’s ability to enhance synaptic connections and improve brain function makes it a potent tool for cognitive health and neurological recovery.
Mood Regulation
One of the primary physiological functions of BDNF is its impact on mood regulation. BDNF enhances the survival and function of serotonergic neurons, contributing to improved mood and emotional well-being. Research indicates that higher levels of BDNF are associated with reduced symptoms of depression and anxiety, making it a valuable component in mental health management.
Neuroprotection
Beyond its cognitive and mood-enhancing effects, BDNF offers significant neuroprotective benefits. This peptide helps protect neurons from damage and supports recovery following neural injury. By promoting the survival and health of neurons, BDNF reduces the risk of neurodegenerative conditions and supports overall brain health.
Increased Synaptic Plasticity
BDNF plays a crucial role in increasing synaptic plasticity, which is the brain’s ability to adapt and reorganize itself. This enhancement in synaptic plasticity contributes to improved learning, memory formation, and overall cognitive performance. BDNF’s positive impact on synaptic plasticity highlights its importance in maintaining and improving brain function.
Direct & scientific
- Backed by 60+ scientific studies
- BPC‑157 has demonstrated consistent healing results across muscle, nerve, and gut models — with early human data showing 92% of patients reporting pain relief.
“Accelerated Healing of Muscles, Ligaments, and Tendons”
Multiple animal and human case studies show BPC-157 significantly speeds up recovery of torn muscles, damaged ligaments, and tendon-to-bone healing — especially relevant for athletes and injury rehabilitation.
PUBMED — article link
BPC comparison to others
- Muscle & joint healing
- Repairs gut lining (IBS, IBD)
- Heals gut tissue
- Boosts blood flow
- Reduces Inflammation
- Activates stem cell repair
- Long-term gut support
- Clinically backed
Product quality guarantee
We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
- $100 HPLC test fee
- Total order amount
- Shipping costs
Frequently bought together
Related products
ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.
Customer reviews










