BDNF (Brain-derived neurotrophic factor) (10mg)

BDNF, a brain-derived neurotrophic factor, is a synthetic peptide with a specific amino acid sequence. The chemical structure and sequence of BDNF are as follows:

Mature peptide sequence:

QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRH

Structure: Contains specific disulfide bridges critical for its function

Enhanced Cognitive Function
BDNF, a critical neurotrophic factor, plays a significant role in enhancing cognitive function. By promoting the growth, development, and maintenance of neurons, BDNF supports neuroplasticity, which is essential for learning and memory. This peptide’s ability to enhance synaptic connections and improve brain function makes it a potent tool for cognitive health and neurological recovery.

Mood Regulation
One of the primary physiological functions of BDNF is its impact on mood regulation. BDNF enhances the survival and function of serotonergic neurons, contributing to improved mood and emotional well-being. Research indicates that higher levels of BDNF are associated with reduced symptoms of depression and anxiety, making it a valuable component in mental health management.

Neuroprotection
Beyond its cognitive and mood-enhancing effects, BDNF offers significant neuroprotective benefits. This peptide helps protect neurons from damage and supports recovery following neural injury. By promoting the survival and health of neurons, BDNF reduces the risk of neurodegenerative conditions and supports overall brain health.

Increased Synaptic Plasticity
BDNF plays a crucial role in increasing synaptic plasticity, which is the brain’s ability to adapt and reorganize itself. This enhancement in synaptic plasticity contributes to improved learning, memory formation, and overall cognitive performance. BDNF’s positive impact on synaptic plasticity highlights its importance in maintaining and improving brain function.